Lineage for d2vk4b3 (2vk4 B:361-561)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122269Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2122270Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2122891Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2122892Protein automated matches [227126] (20 species)
    not a true protein
  7. 2123052Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [255610] (3 PDB entries)
  8. 2123056Domain d2vk4b3: 2vk4 B:361-561 [243899]
    Other proteins in same PDB: d2vk4a2, d2vk4b2, d2vk4c2, d2vk4d2
    automated match to d1qpba3
    complexed with mg, tpp

Details for d2vk4b3

PDB Entry: 2vk4 (more details), 1.95 Å

PDB Description: crystal structure of pyruvate decarboxylase from kluyveromyces lactis
PDB Compounds: (B:) pyruvate decarboxylase

SCOPe Domain Sequences for d2vk4b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vk4b3 c.36.1.0 (B:361-561) automated matches {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]}
dstplkqewvwtqvgeflregdvvitetgtsafginqthfpnntygisqvlwgsigfttg
atlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytierli
hgetaqynciqnwqhlellptfgakdyeavrvsttgewnklttdekfqdntrirlievml
ptmdapsnlvkqaqltaatna

SCOPe Domain Coordinates for d2vk4b3:

Click to download the PDB-style file with coordinates for d2vk4b3.
(The format of our PDB-style files is described here.)

Timeline for d2vk4b3: