| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
| Protein automated matches [227126] (21 species) not a true protein |
| Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [255610] (3 PDB entries) |
| Domain d2vk4b1: 2vk4 B:2-181 [243897] Other proteins in same PDB: d2vk4a2, d2vk4b2, d2vk4c2, d2vk4d2 automated match to d1qpba2 complexed with mg, tpp |
PDB Entry: 2vk4 (more details), 1.95 Å
SCOPe Domain Sequences for d2vk4b1:
Sequence, based on SEQRES records: (download)
>d2vk4b1 c.36.1.0 (B:2-181) automated matches {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]}
seitlgrylferlkqvevqtifglpgdfnlslldniyevpgmrwagnanelnaayaadgy
arlkgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsvssqakqlllhhtlgngd
ftvfhrmssnisettamitdintapaeidrcirttyvsqrpvylglpanlvdltvpasll
>d2vk4b1 c.36.1.0 (B:2-181) automated matches {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]}
seitlgrylferlkqvevqtifglpgdfnlslldniyevpgmrwagnanelnaayaadgy
arlkgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsvssqallhhtlgngdftv
fhrmssnisettamitdintapaeidrcirttyvsqrpvylglpanlvdltvpasll
Timeline for d2vk4b1: