Lineage for d1f4hd4 (1f4h D:731-1023)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1782204Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1782343Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 1782344Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
    automatically mapped to Pfam PF02929
  6. 1782345Protein beta-Galactosidase, domain 5 [49996] (2 species)
  7. 1782353Species Escherichia coli [TaxId:562] [49997] (42 PDB entries)
    Uniprot P00722
  8. 1782469Domain d1f4hd4: 1f4h D:731-1023 [24389]
    Other proteins in same PDB: d1f4ha1, d1f4ha2, d1f4ha3, d1f4ha5, d1f4hb1, d1f4hb2, d1f4hb3, d1f4hb5, d1f4hc1, d1f4hc2, d1f4hc3, d1f4hc5, d1f4hd1, d1f4hd2, d1f4hd3, d1f4hd5
    complexed with mg

Details for d1f4hd4

PDB Entry: 1f4h (more details), 2.8 Å

PDB Description: e. coli (lacz) beta-galactosidase (orthorhombic)
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d1f4hd4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4hd4 b.30.5.1 (D:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d1f4hd4:

Click to download the PDB-style file with coordinates for d1f4hd4.
(The format of our PDB-style files is described here.)

Timeline for d1f4hd4: