Class b: All beta proteins [48724] (176 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein) automatically mapped to Pfam PF02929 |
Protein beta-Galactosidase, domain 5 [49996] (2 species) |
Species Escherichia coli [TaxId:562] [49997] (42 PDB entries) Uniprot P00722 |
Domain d1f4hd4: 1f4h D:731-1023 [24389] Other proteins in same PDB: d1f4ha1, d1f4ha2, d1f4ha3, d1f4ha5, d1f4hb1, d1f4hb2, d1f4hb3, d1f4hb5, d1f4hc1, d1f4hc2, d1f4hc3, d1f4hc5, d1f4hd1, d1f4hd2, d1f4hd3, d1f4hd5 complexed with mg |
PDB Entry: 1f4h (more details), 2.8 Å
SCOPe Domain Sequences for d1f4hd4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f4hd4 b.30.5.1 (D:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]} paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d1f4hd4:
View in 3D Domains from same chain: (mouse over for more information) d1f4hd1, d1f4hd2, d1f4hd3, d1f4hd5 |