Lineage for d2vk1b2 (2vk1 B:182-360)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121033Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2121034Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2121434Family c.31.1.0: automated matches [191352] (1 protein)
    not a true family
  6. 2121435Protein automated matches [190312] (11 species)
    not a true protein
  7. 2121439Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255616] (4 PDB entries)
  8. 2121445Domain d2vk1b2: 2vk1 B:182-360 [243886]
    Other proteins in same PDB: d2vk1a1, d2vk1a3, d2vk1b1, d2vk1b3, d2vk1c1, d2vk1c3, d2vk1d1, d2vk1d3
    automated match to d1qpba1
    complexed with mg, pyr, tpp

Details for d2vk1b2

PDB Entry: 2vk1 (more details), 1.71 Å

PDB Description: crystal structure of the saccharomyces cerevisiae pyruvate decarboxylase variant d28a in complex with its substrate
PDB Compounds: (B:) pyruvate decarboxylase isozyme 1

SCOPe Domain Sequences for d2vk1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vk1b2 c.31.1.0 (B:182-360) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qtpidmslkpndaesekevidtilvldkdaknpviladaccsrhdvkaetkklidltqfp
afvtpmgkgsideqhpryggvyvgtlskpevkeavesadlilsvgallsdfntgsfsysy
ktknivefhsdhmkirnatfpgvqmkfvlqklltaiadaakgykpvavpartpanaavp

SCOPe Domain Coordinates for d2vk1b2:

Click to download the PDB-style file with coordinates for d2vk1b2.
(The format of our PDB-style files is described here.)

Timeline for d2vk1b2: