Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) binds cofactor molecules in the opposite direction than classical Rossmann fold |
Family c.31.1.0: automated matches [191352] (1 protein) not a true family |
Protein automated matches [190312] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255616] (4 PDB entries) |
Domain d2vk1b2: 2vk1 B:182-360 [243886] Other proteins in same PDB: d2vk1a1, d2vk1a3, d2vk1b1, d2vk1b3, d2vk1c1, d2vk1c3, d2vk1d1, d2vk1d3 automated match to d1qpba1 complexed with mg, pyr, tpp |
PDB Entry: 2vk1 (more details), 1.71 Å
SCOPe Domain Sequences for d2vk1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vk1b2 c.31.1.0 (B:182-360) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} qtpidmslkpndaesekevidtilvldkdaknpviladaccsrhdvkaetkklidltqfp afvtpmgkgsideqhpryggvyvgtlskpevkeavesadlilsvgallsdfntgsfsysy ktknivefhsdhmkirnatfpgvqmkfvlqklltaiadaakgykpvavpartpanaavp
Timeline for d2vk1b2: