SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1f4hc4 (1f4h C:731-1023)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2044543Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2044682Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2044683Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
    automatically mapped to Pfam PF02929
  6. 2044684Protein beta-Galactosidase, domain 5 [49996] (2 species)
  7. 2044692Species Escherichia coli [TaxId:562] [49997] (42 PDB entries)
    Uniprot P00722
  8. 2044807Domain d1f4hc4: 1f4h C:731-1023 [24388]
    Other proteins in same PDB: d1f4ha1, d1f4ha2, d1f4ha3, d1f4ha5, d1f4hb1, d1f4hb2, d1f4hb3, d1f4hb5, d1f4hc1, d1f4hc2, d1f4hc3, d1f4hc5, d1f4hd1, d1f4hd2, d1f4hd3, d1f4hd5
    complexed with mg

Details for d1f4hc4

PDB Entry: 1f4h (more details), 2.8 Å

PDB Description: e. coli (lacz) beta-galactosidase (orthorhombic)
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d1f4hc4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4hc4 b.30.5.1 (C:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d1f4hc4:

Click to download the PDB-style file with coordinates for d1f4hc4.
(The format of our PDB-style files is described here.)

Timeline for d1f4hc4: