![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
![]() | Protein automated matches [227126] (15 species) not a true protein |
![]() | Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [255610] (2 PDB entries) |
![]() | Domain d2vjyb1: 2vjy B:2-181 [243873] Other proteins in same PDB: d2vjya2, d2vjyb2, d2vjyc2, d2vjyd2 automated match to d1qpba2 complexed with alk, alu, mg, tpp |
PDB Entry: 2vjy (more details), 2.3 Å
SCOPe Domain Sequences for d2vjyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vjyb1 c.36.1.0 (B:2-181) automated matches {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]} seitlgrylferlkqvevqtifglpgdfnlslldniyevpgmrwagnanelnaayaadgy arlkgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsvssqakqlllhhtlgngd ftvfhrmssnisettamitdintapaeidrcirttyvsqrpvylglpanlvdltvpasll
Timeline for d2vjyb1: