Lineage for d2vjyb1 (2vjy B:2-181)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864564Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2864565Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2865204Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2865205Protein automated matches [227126] (21 species)
    not a true protein
  7. 2865399Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [255610] (3 PDB entries)
  8. 2865418Domain d2vjyb1: 2vjy B:2-181 [243873]
    Other proteins in same PDB: d2vjya2, d2vjyb2, d2vjyc2, d2vjyd2
    automated match to d1qpba2
    complexed with alk, alu, mg, tpp

Details for d2vjyb1

PDB Entry: 2vjy (more details), 2.3 Å

PDB Description: pyruvate decarboxylase from kluyveromyces lactis in complex with the substrate analogue methyl acetylphosphonate
PDB Compounds: (B:) pyruvate decarboxylase

SCOPe Domain Sequences for d2vjyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vjyb1 c.36.1.0 (B:2-181) automated matches {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]}
seitlgrylferlkqvevqtifglpgdfnlslldniyevpgmrwagnanelnaayaadgy
arlkgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsvssqakqlllhhtlgngd
ftvfhrmssnisettamitdintapaeidrcirttyvsqrpvylglpanlvdltvpasll

SCOPe Domain Coordinates for d2vjyb1:

Click to download the PDB-style file with coordinates for d2vjyb1.
(The format of our PDB-style files is described here.)

Timeline for d2vjyb1: