SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2vjya2 (2vjy A:182-360)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107255Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2107256Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2107620Family c.31.1.0: automated matches [191352] (1 protein)
    not a true family
  6. 2107621Protein automated matches [190312] (10 species)
    not a true protein
  7. 2107681Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [255612] (3 PDB entries)
  8. 2107690Domain d2vjya2: 2vjy A:182-360 [243871]
    Other proteins in same PDB: d2vjya1, d2vjya3, d2vjyb1, d2vjyb3, d2vjyc1, d2vjyc3, d2vjyd1, d2vjyd3
    automated match to d1qpba1
    complexed with alk, alu, mg, tpp

Details for d2vjya2

PDB Entry: 2vjy (more details), 2.3 Å

PDB Description: pyruvate decarboxylase from kluyveromyces lactis in complex with the substrate analogue methyl acetylphosphonate
PDB Compounds: (A:) pyruvate decarboxylase

SCOPe Domain Sequences for d2vjya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vjya2 c.31.1.0 (A:182-360) automated matches {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]}
dtpidlslkpndpeaeeevienvlqlikeaknpviladaccsrhdakaetkklidltqfp
afvtpmgkgsidekhprfggvyvgtlsspavkeavesadlvlsvgallsdfntgsfsysy
ktknivefhsdytkirsatfpgvqmkfalqklltkvadaakgykpvpvpsepehneava

SCOPe Domain Coordinates for d2vjya2:

Click to download the PDB-style file with coordinates for d2vjya2.
(The format of our PDB-style files is described here.)

Timeline for d2vjya2: