Lineage for d2vg9a_ (2vg9 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051795Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2051796Protein automated matches [190437] (53 species)
    not a true protein
  7. 2052252Species Neocallimastix patriciarum [TaxId:4758] [237916] (5 PDB entries)
  8. 2052257Domain d2vg9a_: 2vg9 A: [243866]
    automated match to d1pvxa_
    complexed with act, cd; mutant

Details for d2vg9a_

PDB Entry: 2vg9 (more details), 2 Å

PDB Description: Crystal structure of Loop Swap mutant of Necallimastix patriciarum Xyn11A
PDB Compounds: (A:) bifunctional endo-1,4-beta-xylanase a

SCOPe Domain Sequences for d2vg9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vg9a_ b.29.1.0 (A:) automated matches {Neocallimastix patriciarum [TaxId: 4758]}
mkftvgngqnqhkgvndgfsyeiwtnggegsmtlgsgatfkaewnaavnrgnflarrgld
fgsqkkatdydyigldyaatykqtasasgnsrlcvygwfqnrglngvplveyyiiedwvd
wvpdaqgkmvtidgaqykifqmdhtgptinggsetfkqyfsvrqqkrtsghitvsdhfke
wakqgwgignlyevalnaegwqssgvadvtlldvytt

SCOPe Domain Coordinates for d2vg9a_:

Click to download the PDB-style file with coordinates for d2vg9a_.
(The format of our PDB-style files is described here.)

Timeline for d2vg9a_: