SCOPe 2.08: Domain d2vd4a2: 2vd4 A:252-453

Lineage for d2vd4a2 (2vd4 A:252-453)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.0: automated matches [191560] (1 protein)
   not a true family

6. Protein automated matches [190967] (36 species)
   not a true protein

7. Species Haemophilus influenzae [TaxId:727] [231321] (14 PDB entries)

8. Domain d2vd4a2: 2vd4 A:252-453 [243858]
   Other proteins in same PDB: d2vd4a1
   automated match to d2v0ha2
   complexed with mg, p21, pg4, pge, so4

Details for d2vd4a2

PDB Entry: 2vd4, 1.9 Å

PDB Description: structure of small-molecule inhibitor of glmu from haemophilus influenzae reveals an allosteric binding site

PDB Compounds: (A:) Bifunctional protein glmU

SCOPe Domain Sequences for d2vd4a2:

Sequence; same for both SEQRES and ATOM records:

>d2vd4a2 b.81.1.0 (A:252-453) automated matches {Haemophilus influenzae [TaxId: 727]}
vmiydparfdlrgtlehgkdveidvnviiegnvklgdrvkigtgcvlknvvigndveikp
ysvledsivgekaaigpfsrlrpgaelaaethvgnfveikkstvgkgskvnhltyvgdse
igsncnigagvitcnydgankfktiigddvfvgsdtqlvapvkvangatigagttitrdv
genelvitrvaqrhiqgwqrpi

Timeline for d2vd4a2:

• d2vd4a2 first appeared in SCOPe 2.04
  
• d2vd4a2 appears in SCOPe 2.07