![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins) |
![]() | Protein automated matches [190880] (5 species) not a true protein |
![]() | Species Rhodococcus rhodochrous [TaxId:1829] [189127] (16 PDB entries) |
![]() | Domain d2v9za_: 2v9z A: [243854] automated match to d3sk0a_ mutant |
PDB Entry: 2v9z (more details), 3 Å
SCOPe Domain Sequences for d2v9za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v9za_ c.69.1.8 (A:) automated matches {Rhodococcus rhodochrous [TaxId: 1829]} eigtgfpfdphyvevlgermhyvdvgprdgtpvlflhgnptssylwrniiphvapshrci apdligmgksdkpdldyffddhvryldafiealgleevvlvihdwgsalgfhwakrnper vkgiacmefirpiptwdefhhtevaeeqdhaeaaretfqafrtadvgreliidqnafier vlpggvvrpltevemdhyrepflkpvdreplwrfpnelpiagepanivalveaymnwlhq spvpkllfwgtpgalippaeaarlaeslpncktvdigpglhylqednpdligseiarwlp al
Timeline for d2v9za_: