SCOPe 2.05: Domain d2v9db_: 2v9d B:

Lineage for d2v9db_ (2v9d B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (63 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [226105] (8 PDB entries)

8. Domain d2v9db_: 2v9d B: [243851]
   automated match to d3eb2a_

Details for d2v9db_

PDB Entry: 2v9d, 2.15 Å

PDB Description: crystal structure of yage, a prophage protein belonging to the dihydrodipicolinic acid synthase family from e. coli k12

PDB Compounds: (B:) yage

SCOPe Domain Sequences for d2v9db_:

Sequence; same for both SEQRES and ATOM records:

>d2v9db_ c.1.10.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
alftgiippvstiftadgqldkpgtaaliddlikagvdglfflgsggefsqlgaeerkai
arfaidhvdrrvpvligtggtnaretielsqhaqqagadgivvinpyywkvseanliryf
eqvadsvtlpvmlynfpaltgqdltpalvktladsrsniigikdtidsvahlrsmihtvk
gahphftvlcgyddhlfntlllggdgaisasgnfapqvsvnllkawrdgdvakaagyhqt
llqipqmyqldtpfvnvikeaivlcgrpvsthvlppaspldeprkaqlktllqqlklc

Timeline for d2v9db_:

• d2v9db_ first appeared in SCOPe 2.04
  
• d2v9db_ appears in SCOPe 2.06
  
• d2v9db_ appears in the current release, SCOPe 2.08