Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (57 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [226105] (5 PDB entries) |
Domain d2v9da_: 2v9d A: [243850] automated match to d3eb2a_ |
PDB Entry: 2v9d (more details), 2.15 Å
SCOPe Domain Sequences for d2v9da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v9da_ c.1.10.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} alftgiippvstiftadgqldkpgtaaliddlikagvdglfflgsggefsqlgaeerkai arfaidhvdrrvpvligtggtnaretielsqhaqqagadgivvinpyywkvseanliryf eqvadsvtlpvmlynfpaltgqdltpalvktladsrsniigikdtidsvahlrsmihtvk gahphftvlcgyddhlfntlllggdgaisasgnfapqvsvnllkawrdgdvakaagyhqt llqipqmyqldtpfvnvikeaivlcgrpvsthvlppaspldeprkaqlktllqqlklc
Timeline for d2v9da_: