Lineage for d2v9da_ (2v9d A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1571860Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1573064Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 1573065Protein automated matches [190115] (57 species)
    not a true protein
  7. 1573200Species Escherichia coli K-12 [TaxId:83333] [226105] (5 PDB entries)
  8. 1573201Domain d2v9da_: 2v9d A: [243850]
    automated match to d3eb2a_

Details for d2v9da_

PDB Entry: 2v9d (more details), 2.15 Å

PDB Description: crystal structure of yage, a prophage protein belonging to the dihydrodipicolinic acid synthase family from e. coli k12
PDB Compounds: (A:) yage

SCOPe Domain Sequences for d2v9da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v9da_ c.1.10.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
alftgiippvstiftadgqldkpgtaaliddlikagvdglfflgsggefsqlgaeerkai
arfaidhvdrrvpvligtggtnaretielsqhaqqagadgivvinpyywkvseanliryf
eqvadsvtlpvmlynfpaltgqdltpalvktladsrsniigikdtidsvahlrsmihtvk
gahphftvlcgyddhlfntlllggdgaisasgnfapqvsvnllkawrdgdvakaagyhqt
llqipqmyqldtpfvnvikeaivlcgrpvsthvlppaspldeprkaqlktllqqlklc

SCOPe Domain Coordinates for d2v9da_:

Click to download the PDB-style file with coordinates for d2v9da_.
(The format of our PDB-style files is described here.)

Timeline for d2v9da_: