Lineage for d2v70a_ (2v70 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1834683Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 1834752Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 1834946Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 1834947Protein automated matches [190787] (10 species)
    not a true protein
  7. 1834953Species Human (Homo sapiens) [TaxId:9606] [188042] (11 PDB entries)
  8. 1834974Domain d2v70a_: 2v70 A: [243841]
    automated match to d2v9tb_
    complexed with nag

Details for d2v70a_

PDB Entry: 2v70 (more details), 3.01 Å

PDB Description: third lrr domain of human slit2
PDB Compounds: (A:) slit homolog 2 protein n-product

SCOPe Domain Sequences for d2v70a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v70a_ c.10.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
acpekcrcegttvdcsnqklnkipehipqytaelrlnnneftvleatgifkklpqlrkin
fsnnkitdieegafegasgvneilltsnrlenvqhkmfkgleslktlmlrsnritcvgnd
sfiglssvrllslydnqittvapgafdtlhslstlnllanpfncncylawlgewlrkkri
vtgnprcqkpyflkeipiqdvaiqdftcdd

SCOPe Domain Coordinates for d2v70a_:

Click to download the PDB-style file with coordinates for d2v70a_.
(The format of our PDB-style files is described here.)

Timeline for d2v70a_: