Lineage for d2v37a_ (2v37 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763414Superfamily b.1.6: Cadherin-like [49313] (4 families) (S)
  5. 2763525Family b.1.6.0: automated matches [191376] (1 protein)
    not a true family
  6. 2763526Protein automated matches [190458] (4 species)
    not a true protein
  7. 2763541Species Human (Homo sapiens) [TaxId:9606] [255601] (21 PDB entries)
  8. 2763598Domain d2v37a_: 2v37 A: [243837]
    automated match to d2omxb_

Details for d2v37a_

PDB Entry: 2v37 (more details)

PDB Description: solution structure of the n-terminal extracellular domain of human t- cadherin
PDB Compounds: (A:) cadherin-13

SCOPe Domain Sequences for d2v37a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v37a_ b.1.6.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sivvspilipenqrqpfprdvgkvvdsdrperskfrltgkgvdqepkgifrinentgsvs
vtrtldreviavyqlfvettdvngktlegpvplevividqndnrp

SCOPe Domain Coordinates for d2v37a_:

Click to download the PDB-style file with coordinates for d2v37a_.
(The format of our PDB-style files is described here.)

Timeline for d2v37a_: