Lineage for d1f4ab4 (1f4a B:731-1023)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781620Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2781621Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
    automatically mapped to Pfam PF02929
  6. 2781622Protein beta-Galactosidase, domain 5 [49996] (2 species)
  7. 2781630Species Escherichia coli [TaxId:562] [49997] (46 PDB entries)
    Uniprot P00722
  8. 2781836Domain d1f4ab4: 1f4a B:731-1023 [24383]
    Other proteins in same PDB: d1f4aa1, d1f4aa2, d1f4aa3, d1f4aa5, d1f4ab1, d1f4ab2, d1f4ab3, d1f4ab5, d1f4ac1, d1f4ac2, d1f4ac3, d1f4ac5, d1f4ad1, d1f4ad2, d1f4ad3, d1f4ad5
    complexed with mg

Details for d1f4ab4

PDB Entry: 1f4a (more details), 2.8 Å

PDB Description: e. coli (lacz) beta-galactosidase (ncs constrained monomer- orthorhombic)
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d1f4ab4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4ab4 b.30.5.1 (B:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d1f4ab4:

Click to download the PDB-style file with coordinates for d1f4ab4.
(The format of our PDB-style files is described here.)

Timeline for d1f4ab4: