SCOPe 2.04: Domain d2uyeb_: 2uye B:

Lineage for d2uyeb_ (2uye B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (42 proteins)

6. Protein automated matches [190140] (17 species)
   not a true protein

7. Species Burkholderia cepacia [TaxId:292] [255595] (2 PDB entries)

8. Domain d2uyeb_: 2uye B: [243827]
   automated match to d1utbb_
   protein/DNA complex; complexed with gol, scn; mutant

Details for d2uyeb_

PDB Entry: 2uye, 2.2 Å

PDB Description: double mutant y110s,f111v dntr from burkholderia sp. strain dnt in complex with thiocyanate

PDB Compounds: (B:) Regulatory protein

SCOPe Domain Sequences for d2uyeb_:

Sequence, based on SEQRES records:

>d2uyeb_ c.94.1.1 (B:) automated matches {Burkholderia cepacia [TaxId: 292]}
alntlqtalttrdsfdpfastrtfnlamtdigemsvmpplmealaqraphiqistlrpna
gnlkedmesgavdlalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqfsele
hvgvvalntghgevdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcev
pfglttsphpaklpdiainlfwhakynrdpgnmwlrqlfvelfsea

Sequence, based on observed residues (ATOM records):

>d2uyeb_ c.94.1.1 (B:) automated matches {Burkholderia cepacia [TaxId: 292]}
alntlqtalttrdsfdpfastrtfnlamtdigemsvmpplmealaqraphiqistlrpng
nlkedmesgavdlalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqfseleh
vgvvalntghgevdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevp
fglttsphpaklpdiainlfwhakynrdpgnmwlrqlfvelfsea

Timeline for d2uyeb_:

• d2uyeb_ is new in SCOPe 2.04-stable
  
• d2uyeb_ appears in SCOPe 2.05
  
• d2uyeb_ appears in the current release, SCOPe 2.08