Lineage for d2uyeb_ (2uye B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914680Protein automated matches [190140] (37 species)
    not a true protein
  7. 2914691Species Burkholderia cepacia [TaxId:292] [255595] (2 PDB entries)
  8. 2914695Domain d2uyeb_: 2uye B: [243827]
    Other proteins in same PDB: d2uyea2
    automated match to d1utbb_
    protein/DNA complex; complexed with gol, scn; mutant

Details for d2uyeb_

PDB Entry: 2uye (more details), 2.2 Å

PDB Description: double mutant y110s,f111v dntr from burkholderia sp. strain dnt in complex with thiocyanate
PDB Compounds: (B:) Regulatory protein

SCOPe Domain Sequences for d2uyeb_:

Sequence, based on SEQRES records: (download)

>d2uyeb_ c.94.1.1 (B:) automated matches {Burkholderia cepacia [TaxId: 292]}
alntlqtalttrdsfdpfastrtfnlamtdigemsvmpplmealaqraphiqistlrpna
gnlkedmesgavdlalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqfsele
hvgvvalntghgevdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcev
pfglttsphpaklpdiainlfwhakynrdpgnmwlrqlfvelfsea

Sequence, based on observed residues (ATOM records): (download)

>d2uyeb_ c.94.1.1 (B:) automated matches {Burkholderia cepacia [TaxId: 292]}
alntlqtalttrdsfdpfastrtfnlamtdigemsvmpplmealaqraphiqistlrpng
nlkedmesgavdlalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqfseleh
vgvvalntghgevdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevp
fglttsphpaklpdiainlfwhakynrdpgnmwlrqlfvelfsea

SCOPe Domain Coordinates for d2uyeb_:

Click to download the PDB-style file with coordinates for d2uyeb_.
(The format of our PDB-style files is described here.)

Timeline for d2uyeb_: