![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
![]() | Protein automated matches [190140] (37 species) not a true protein |
![]() | Species Burkholderia cepacia [TaxId:292] [255595] (2 PDB entries) |
![]() | Domain d2uyeb_: 2uye B: [243827] Other proteins in same PDB: d2uyea2 automated match to d1utbb_ protein/DNA complex; complexed with gol, scn; mutant |
PDB Entry: 2uye (more details), 2.2 Å
SCOPe Domain Sequences for d2uyeb_:
Sequence, based on SEQRES records: (download)
>d2uyeb_ c.94.1.1 (B:) automated matches {Burkholderia cepacia [TaxId: 292]} alntlqtalttrdsfdpfastrtfnlamtdigemsvmpplmealaqraphiqistlrpna gnlkedmesgavdlalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqfsele hvgvvalntghgevdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcev pfglttsphpaklpdiainlfwhakynrdpgnmwlrqlfvelfsea
>d2uyeb_ c.94.1.1 (B:) automated matches {Burkholderia cepacia [TaxId: 292]} alntlqtalttrdsfdpfastrtfnlamtdigemsvmpplmealaqraphiqistlrpng nlkedmesgavdlalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqfseleh vgvvalntghgevdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevp fglttsphpaklpdiainlfwhakynrdpgnmwlrqlfvelfsea
Timeline for d2uyeb_: