SCOPe 2.08: Domain d2uyea1: 2uye A:88-301

Lineage for d2uyea1 (2uye A:88-301)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein automated matches [190140] (37 species)
   not a true protein

7. Species Burkholderia cepacia [TaxId:292] [255595] (2 PDB entries)

8. Domain d2uyea1: 2uye A:88-301 [243826]
   Other proteins in same PDB: d2uyea2
   automated match to d1utbb_
   protein/DNA complex; complexed with gol, scn; mutant

Details for d2uyea1

PDB Entry: 2uye, 2.2 Å

PDB Description: double mutant y110s,f111v dntr from burkholderia sp. strain dnt in complex with thiocyanate

PDB Compounds: (A:) Regulatory protein

SCOPe Domain Sequences for d2uyea1:

Sequence; same for both SEQRES and ATOM records:

>d2uyea1 c.94.1.1 (A:88-301) automated matches {Burkholderia cepacia [TaxId: 292]}
dsfdpfastrtfnlamtdigemsvmpplmealaqraphiqistlrpnagnlkedmesgav
dlalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqfselehvgvvalntghg
evdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpak
lpdiainlfwhakynrdpgnmwlrqlfvelfsea

Timeline for d2uyea1:

• d2uyea1 first appeared in SCOPe 2.04, called d2uyea_
  
• d2uyea1 appears in SCOPe 2.07