Lineage for d2uuni_ (2uun I:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2688849Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2689048Protein automated matches [190531] (23 species)
    not a true protein
  7. 2689086Species Leptolyngbya sp. [TaxId:47254] [255594] (1 PDB entry)
  8. 2689095Domain d2uuni_: 2uun I: [243807]
    automated match to d1gh0a_
    complexed with bla, cyc

Details for d2uuni_

PDB Entry: 2uun (more details), 3 Å

PDB Description: crystal structure of c-phycocyanin from phormidium, lyngbya spp. (marine) and spirulina sp. (fresh water) shows two different ways of energy transfer between two hexamers.
PDB Compounds: (I:) c-phycocyanin

SCOPe Domain Sequences for d2uuni_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uuni_ a.1.1.3 (I:) automated matches {Leptolyngbya sp. [TaxId: 47254]}
mktpltdavstadsqgrflssteiqvafgrfrqaaaglsaataltsaadalisgaaqavy
nsfpyttcmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagidevnr
tfelspswyiealkyikanhglagdaaaeansyldyainals

SCOPe Domain Coordinates for d2uuni_:

Click to download the PDB-style file with coordinates for d2uuni_.
(The format of our PDB-style files is described here.)

Timeline for d2uuni_: