Lineage for d2uulx_ (2uul X:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1718119Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1718294Protein automated matches [190531] (16 species)
    not a true protein
  7. 1718371Species Phormidium sp. [TaxId:1199] [255592] (1 PDB entry)
  8. 1718395Domain d2uulx_: 2uul X: [243798]
    automated match to d1gh0b_
    complexed with bla, cyc

Details for d2uulx_

PDB Entry: 2uul (more details), 3.1 Å

PDB Description: crystal structure of c-phycocyanin from phormidium, lyngbya spp. (marine) and spirulina sp. (fresh water) shows two different ways of energy transfer between two hexamers.
PDB Compounds: (X:) C-phycocyanin beta chain

SCOPe Domain Sequences for d2uulx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uulx_ a.1.1.3 (X:) automated matches {Phormidium sp. [TaxId: 1199]}
mfdaftkvaaqadtrgemvsvaqidalsqmvaeankrldavnritanastvvsnaaralf
aeqpqliapggnaytsnrmaaclrdmeiilryvtyavfagdasaledrclnglretysal
gtpgssvavgvgkmkeaalaivndpagitpgdcsalaseiagyfdraaaavs

SCOPe Domain Coordinates for d2uulx_:

Click to download the PDB-style file with coordinates for d2uulx_.
(The format of our PDB-style files is described here.)

Timeline for d2uulx_: