SCOPe 2.08: Domain d2rtua1: 2rtu A:4-87

Lineage for d2rtua1 (2rtu A:4-87)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.21: HMG-box [47094] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.21.1: HMG-box [47095] (2 families)

5. Family a.21.1.1: HMG-box [47096] (10 proteins)

6. Protein automated matches [190434] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187328] (5 PDB entries)

8. Domain d2rtua1: 2rtu A:4-87 [243773]
   Other proteins in same PDB: d2rtua2
   automated match to d1aaba_

Details for d2rtua1

PDB Entry: 2rtu

PDB Description: solution structure of oxidized human hmgb1 a box

PDB Compounds: (A:) High mobility group protein B1

SCOPe Domain Sequences for d2rtua1:

Sequence; same for both SEQRES and ATOM records:

>d2rtua1 a.21.1.1 (A:4-87) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgkgdpkkprgkmssyaffvqtcreehkkkhpdasvnfsefskkcserwktmsakekgkf
edmakadkaryeremktyippkge

Timeline for d2rtua1:

• d2rtua1 first appeared in SCOPe 2.04, called d2rtua_
  
• d2rtua1 appears in SCOPe 2.07