Lineage for d2rsya1 (2rsy A:80-173)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2571840Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2571841Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2572318Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2572319Protein automated matches [190561] (4 species)
    not a true protein
  7. 2572525Species Norway rat (Rattus norvegicus) [TaxId:10116] [255150] (2 PDB entries)
  8. 2572526Domain d2rsya1: 2rsy A:80-173 [243772]
    Other proteins in same PDB: d2rsya2
    automated match to d3eaza_

Details for d2rsya1

PDB Entry: 2rsy (more details)

PDB Description: solution structure of the sh2 domain of csk in complex with a phosphopeptide from cbp
PDB Compounds: (A:) Tyrosine-protein kinase CSK

SCOPe Domain Sequences for d2rsya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rsya1 d.93.1.0 (A:80-173) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mpwfhgkitreqaerllyppetglflvrestnypgdytlcvscegkvehyrimyhaskls
ideevyfenlmqlvehyttdadglctrlikpkvm

SCOPe Domain Coordinates for d2rsya1:

Click to download the PDB-style file with coordinates for d2rsya1.
(The format of our PDB-style files is described here.)

Timeline for d2rsya1: