SCOPe 2.08: Domain d2rsya1: 2rsy A:80-173

Lineage for d2rsya1 (2rsy A:80-173)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.0: automated matches [191409] (1 protein)
   not a true family

6. Protein automated matches [190561] (4 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [255150] (2 PDB entries)

8. Domain d2rsya1: 2rsy A:80-173 [243772]
   Other proteins in same PDB: d2rsya2
   automated match to d3eaza_

Details for d2rsya1

PDB Entry: 2rsy

PDB Description: solution structure of the sh2 domain of csk in complex with a phosphopeptide from cbp

PDB Compounds: (A:) Tyrosine-protein kinase CSK

SCOPe Domain Sequences for d2rsya1:

Sequence; same for both SEQRES and ATOM records:

>d2rsya1 d.93.1.0 (A:80-173) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mpwfhgkitreqaerllyppetglflvrestnypgdytlcvscegkvehyrimyhaskls
ideevyfenlmqlvehyttdadglctrlikpkvm

Timeline for d2rsya1:

• d2rsya1 first appeared in SCOPe 2.04, called d2rsya_
  
• d2rsya1 appears in SCOPe 2.07