Lineage for d2rsqa_ (2rsq A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2196856Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2196990Family d.58.17.0: automated matches [191590] (1 protein)
    not a true family
  6. 2196991Protein automated matches [191063] (8 species)
    not a true protein
  7. 2196994Species Human (Homo sapiens) [TaxId:9606] [254969] (11 PDB entries)
  8. 2196996Domain d2rsqa_: 2rsq A: [243769]
    automated match to d3k7rh_
    complexed with cu1

Details for d2rsqa_

PDB Entry: 2rsq (more details)

PDB Description: Copper(I) loaded form of the first domain of the human copper chaperone for SOD1, CCS
PDB Compounds: (A:) copper chaperone for superoxide dismutase

SCOPe Domain Sequences for d2rsqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rsqa_ d.58.17.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gtlctlefavqmtcqscvdavrkslqgvagvqdvevhledqmvlvhttlpsqevqalleg
tgrqavlkgmg

SCOPe Domain Coordinates for d2rsqa_:

Click to download the PDB-style file with coordinates for d2rsqa_.
(The format of our PDB-style files is described here.)

Timeline for d2rsqa_: