| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) ![]() |
| Family d.58.17.0: automated matches [191590] (1 protein) not a true family |
| Protein automated matches [191063] (8 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [254969] (11 PDB entries) |
| Domain d2rsqa_: 2rsq A: [243769] automated match to d3k7rh_ complexed with cu1 |
PDB Entry: 2rsq (more details)
SCOPe Domain Sequences for d2rsqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rsqa_ d.58.17.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gtlctlefavqmtcqscvdavrkslqgvagvqdvevhledqmvlvhttlpsqevqalleg
tgrqavlkgmg
Timeline for d2rsqa_: