SCOPe 2.07: Domain d2rsca1: 2rsc A:2-120

Lineage for d2rsca1 (2rsc A:2-120)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.0: automated matches [191411] (1 protein)
   not a true family

6. Protein automated matches [190563] (18 species)
   not a true protein

7. Species Silkworm (Bombyx mori) [TaxId:7091] [255591] (1 PDB entry)

8. Domain d2rsca1: 2rsc A:2-120 [243765]
   Other proteins in same PDB: d2rsca2
   automated match to d3cb7a_

Details for d2rsca1

PDB Entry: 2rsc

PDB Description: Solution Structure of the bombyx mori lysozyme

PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d2rsca1:

Sequence; same for both SEQRES and ATOM records:

>d2rsca1 d.2.1.0 (A:2-120) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
ktftrcglvhelrkhgfeenlmrnwvclvehessrdtsktntnrngskdyglfqindryw
cskgaspgkdcnvkcsdlltdditkaakcakkiykrhrfdawygwknhcqgslpdissc

Timeline for d2rsca1:

• d2rsca1 first appeared in SCOPe 2.04, called d2rsca_
  
• d2rsca1 appears in SCOPe 2.06
  
• d2rsca1 appears in the current release, SCOPe 2.08