Lineage for d2rsca_ (2rsc A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1887016Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1887017Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1888916Family d.2.1.0: automated matches [191411] (1 protein)
    not a true family
  6. 1888917Protein automated matches [190563] (12 species)
    not a true protein
  7. 1888961Species Silkworm (Bombyx mori) [TaxId:7091] [255591] (1 PDB entry)
  8. 1888962Domain d2rsca_: 2rsc A: [243765]
    automated match to d3cb7a_

Details for d2rsca_

PDB Entry: 2rsc (more details)

PDB Description: Solution Structure of the bombyx mori lysozyme
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d2rsca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rsca_ d.2.1.0 (A:) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
gktftrcglvhelrkhgfeenlmrnwvclvehessrdtsktntnrngskdyglfqindry
wcskgaspgkdcnvkcsdlltdditkaakcakkiykrhrfdawygwknhcqgslpdissc

SCOPe Domain Coordinates for d2rsca_:

Click to download the PDB-style file with coordinates for d2rsca_.
(The format of our PDB-style files is described here.)

Timeline for d2rsca_: