SCOPe 2.06: Domain d2rs8a1: 2rs8 A:68-153

Lineage for d2rs8a1 (2rs8 A:68-153)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein Non-POU domain-containing octamer-binding protein, NonO [143354] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [143355] (2 PDB entries)
   Uniprot Q99K48 68-153

8. Domain d2rs8a1: 2rs8 A:68-153 [243764]
   Other proteins in same PDB: d2rs8a2, d2rs8a3
   automated match to d1wf2a_

Details for d2rs8a1

PDB Entry: 2rs8

PDB Description: Solution structure of the N-terminal RNA recognition motif of NonO

PDB Compounds: (A:) Non-POU domain-containing octamer-binding protein

SCOPe Domain Sequences for d2rs8a1:

Sequence; same for both SEQRES and ATOM records:

>d2rs8a1 d.58.7.1 (A:68-153) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]}
gektftqrsrlfvgnlppditeeemrklfekygkagevfihkdkgfgfirletrtlaeia
kveldnmplrgkqlrvrfachsaslt

Timeline for d2rs8a1:

• d2rs8a1 first appeared in SCOPe 2.04, called d2rs8a_
  
• d2rs8a1 was called d2rs8a_ in SCOPe 2.05
  
• d2rs8a1 appears in SCOPe 2.07
  
• d2rs8a1 appears in the current release, SCOPe 2.08