Lineage for d2rs8a_ (2rs8 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1652149Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1652150Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1652269Protein Non-POU domain-containing octamer-binding protein, NonO [143354] (1 species)
  7. 1652270Species Mouse (Mus musculus) [TaxId:10090] [143355] (2 PDB entries)
    Uniprot Q99K48 68-153
  8. 1652271Domain d2rs8a_: 2rs8 A: [243764]
    automated match to d1wf2a_

Details for d2rs8a_

PDB Entry: 2rs8 (more details)

PDB Description: Solution structure of the N-terminal RNA recognition motif of NonO
PDB Compounds: (A:) Non-POU domain-containing octamer-binding protein

SCOPe Domain Sequences for d2rs8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rs8a_ d.58.7.1 (A:) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]}
gssgssggektftqrsrlfvgnlppditeeemrklfekygkagevfihkdkgfgfirlet
rtlaeiakveldnmplrgkqlrvrfachsasltsgpssg

SCOPe Domain Coordinates for d2rs8a_:

Click to download the PDB-style file with coordinates for d2rs8a_.
(The format of our PDB-style files is described here.)

Timeline for d2rs8a_: