![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
![]() | Superfamily b.62.1: Cyclophilin-like [50891] (5 families) ![]() |
![]() | Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
![]() | Protein Peptidyl-prolyl cis-trans isomerase A, PpiA [50901] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [50902] (7 PDB entries) Uniprot P20752 |
![]() | Domain d2rs4a_: 2rs4 A: [243763] automated match to d1lopa_ |
PDB Entry: 2rs4 (more details)
SCOPe Domain Sequences for d2rs4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rs4a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} mvtfhtnhgdiviktfddkapetvknfldycregfynntifhrvingfmiqgggfepgmk qkatkepikneannglkntrgtlamartqaphsataqffinvvdndflnfsgeslqgwgy cvfaevvdgmdvvdkikgvatgrsgmhqdvpkedviiesvtvse
Timeline for d2rs4a_: