Lineage for d2rrta1 (2rrt A:2-72)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319424Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2319425Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2319893Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2319950Protein Calmodulin [47516] (12 species)
  7. 2319951Species African clawed frog (Xenopus laevis) [TaxId:8355] [47521] (25 PDB entries)
  8. 2319964Domain d2rrta1: 2rrt A:2-72 [243761]
    Other proteins in same PDB: d2rrta2
    automated match to d1cmga_
    mutant

Details for d2rrta1

PDB Entry: 2rrt (more details)

PDB Description: Solution structure of Magnesium-bound form of calmodulin C-domain E104D/E140D mutant
PDB Compounds: (A:) calmodulin

SCOPe Domain Sequences for d2rrta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rrta1 a.39.1.5 (A:2-72) Calmodulin {African clawed frog (Xenopus laevis) [TaxId: 8355]}
dtdseeeireafrvfdkdgngyisaadlrhvmtnlgekltdeevdemireadidgdgqvn
yedfvqmmtak

SCOPe Domain Coordinates for d2rrta1:

Click to download the PDB-style file with coordinates for d2rrta1.
(The format of our PDB-style files is described here.)

Timeline for d2rrta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rrta2