SCOPe 2.08: Domain d2rrta1: 2rrt A:2-72

Lineage for d2rrta1 (2rrt A:2-72)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calmodulin [47516] (13 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47521] (20 PDB entries)

8. Domain d2rrta1: 2rrt A:2-72 [243761]
   Other proteins in same PDB: d2rrta2
   automated match to d1cmga_
   mutant
   fragment; missing more than one-third of the common structure and/or sequence

Details for d2rrta1

PDB Entry: 2rrt

PDB Description: Solution structure of Magnesium-bound form of calmodulin C-domain E104D/E140D mutant

PDB Compounds: (A:) calmodulin

SCOPe Domain Sequences for d2rrta1:

Sequence; same for both SEQRES and ATOM records:

>d2rrta1 a.39.1.5 (A:2-72) Calmodulin {African clawed frog (Xenopus laevis) [TaxId: 8355]}
dtdseeeireafrvfdkdgngyisaadlrhvmtnlgekltdeevdemireadidgdgqvn
yedfvqmmtak

Timeline for d2rrta1:

• d2rrta1 first appeared in SCOPe 2.04, called d2rrta_
  
• d2rrta1 appears in SCOPe 2.07