Lineage for d2rraa_ (2rra A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908987Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 1908988Protein automated matches [190896] (9 species)
    not a true protein
  7. 1909006Species Human (Homo sapiens) [TaxId:9606] [188315] (74 PDB entries)
  8. 1909074Domain d2rraa_: 2rra A: [243757]
    automated match to d2cpza1
    protein/RNA complex

Details for d2rraa_

PDB Entry: 2rra (more details)

PDB Description: solution structure of rna binding domain in human tra2 beta protein in complex with rna (gaagaa)
PDB Compounds: (A:) cDNA FLJ40872 fis, clone TUTER2000283, highly similar to Homo sapiens transformer-2-beta (SFRS10) gene

SCOPe Domain Sequences for d2rraa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rraa_ d.58.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgnranpdpncclgvfglslytterdlrevfskygpiadvsivydqqsrrsrgfa
fvyfenvddakeakerangmeldgrrirvdfsitkrpht

SCOPe Domain Coordinates for d2rraa_:

Click to download the PDB-style file with coordinates for d2rraa_.
(The format of our PDB-style files is described here.)

Timeline for d2rraa_: