Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.204: Ribosome binding protein Y (YfiA homologue) [69753] (1 superfamily) beta-alpha-beta(3)-alpha; 2 layers; mixed sheet 1234, strand 3 is antiparallel to the rest |
Superfamily d.204.1: Ribosome binding protein Y (YfiA homologue) [69754] (2 families) automatically mapped to Pfam PF02482 |
Family d.204.1.0: automated matches [227270] (1 protein) not a true family |
Protein automated matches [227070] (6 species) not a true protein |
Species Escherichia coli [TaxId:562] [255587] (1 PDB entry) |
Domain d2rqla_: 2rql A: [243752] automated match to d4heia_ |
PDB Entry: 2rql (more details)
SCOPe Domain Sequences for d2rqla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rqla_ d.204.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]} mqlnitgnnveitealrefvtakfakleqyfdrinqvyvvlkvekvthtsdatlhvngge ihasaegqdmyaaidglidklarqltkhkdklkqh
Timeline for d2rqla_: