SCOPe 2.04: Domain d2rqla_: 2rql A:

Lineage for d2rqla_ (2rql A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.204: Ribosome binding protein Y (YfiA homologue) [69753] (1 superfamily)
   beta-alpha-beta(3)-alpha; 2 layers; mixed sheet 1234, strand 3 is antiparallel to the rest

4. Superfamily d.204.1: Ribosome binding protein Y (YfiA homologue) [69754] (2 families)
   automatically mapped to Pfam PF02482

5. Family d.204.1.0: automated matches [227270] (1 protein)
   not a true family

6. Protein automated matches [227070] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [255587] (1 PDB entry)

8. Domain d2rqla_: 2rql A: [243752]
   automated match to d4heia_

Details for d2rqla_

PDB Entry: 2rql

PDB Description: solution structure of the e. coli ribosome hibernation promoting factor hpf

PDB Compounds: (A:) Probable sigma-54 modulation protein

SCOPe Domain Sequences for d2rqla_:

Sequence; same for both SEQRES and ATOM records:

>d2rqla_ d.204.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
mqlnitgnnveitealrefvtakfakleqyfdrinqvyvvlkvekvthtsdatlhvngge
ihasaegqdmyaaidglidklarqltkhkdklkqh

Timeline for d2rqla_:

• d2rqla_ is new in SCOPe 2.04-stable
  
• d2rqla_ appears in SCOPe 2.05
  
• d2rqla_ appears in the current release, SCOPe 2.08