Lineage for d2rqla_ (2rql A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006182Fold d.204: Ribosome binding protein Y (YfiA homologue) [69753] (1 superfamily)
    beta-alpha-beta(3)-alpha; 2 layers; mixed sheet 1234, strand 3 is antiparallel to the rest
  4. 3006183Superfamily d.204.1: Ribosome binding protein Y (YfiA homologue) [69754] (2 families) (S)
    automatically mapped to Pfam PF02482
  5. 3006200Family d.204.1.0: automated matches [227270] (1 protein)
    not a true family
  6. 3006201Protein automated matches [227070] (6 species)
    not a true protein
  7. 3006210Species Escherichia coli [TaxId:562] [255587] (1 PDB entry)
  8. 3006211Domain d2rqla_: 2rql A: [243752]
    automated match to d4heia_

Details for d2rqla_

PDB Entry: 2rql (more details)

PDB Description: solution structure of the e. coli ribosome hibernation promoting factor hpf
PDB Compounds: (A:) Probable sigma-54 modulation protein

SCOPe Domain Sequences for d2rqla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rqla_ d.204.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
mqlnitgnnveitealrefvtakfakleqyfdrinqvyvvlkvekvthtsdatlhvngge
ihasaegqdmyaaidglidklarqltkhkdklkqh

SCOPe Domain Coordinates for d2rqla_:

Click to download the PDB-style file with coordinates for d2rqla_.
(The format of our PDB-style files is described here.)

Timeline for d2rqla_: