Class a: All alpha proteins [46456] (289 folds) |
Fold a.144: PABP domain-like [63569] (2 superfamilies) 4 helices; an orthogonal array |
Superfamily a.144.1: PABC (PABP) domain [63570] (2 families) |
Family a.144.1.1: PABC (PABP) domain [63571] (3 proteins) |
Protein automated matches [191271] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226585] (4 PDB entries) |
Domain d2rqhb_: 2rqh B: [243751] automated match to d4iveb_ protein/RNA complex |
PDB Entry: 2rqh (more details)
SCOPe Domain Sequences for d2rqhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rqhb_ a.144.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gqepltasmlasappqeqkqmlgerlfpliqamhptlagkitgmlleidnsellhmlesp eslrskvdeavavlqahqakeaa
Timeline for d2rqhb_: