SCOPe 2.04: Domain d2rqgb_: 2rqg B:

Lineage for d2rqgb_ (2rqg B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.144: PABP domain-like [63569] (2 superfamilies)
   4 helices; an orthogonal array

4. Superfamily a.144.1: PABC (PABP) domain [63570] (2 families)

5. Family a.144.1.1: PABC (PABP) domain [63571] (3 proteins)

6. Protein automated matches [191271] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226585] (4 PDB entries)

8. Domain d2rqgb_: 2rqg B: [243750]
   automated match to d4iveb_
   protein/RNA complex

Details for d2rqgb_

PDB Entry: 2rqg

PDB Description: structure of gspt1/erf3a-pabc

PDB Compounds: (B:) polyadenylate-binding protein 1

SCOPe Domain Sequences for d2rqgb_:

Sequence; same for both SEQRES and ATOM records:

>d2rqgb_ a.144.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqepltasmlasappqeqkqmlgerlfpliqamhptlagkitgmlleidnsellhmlesp
eslrskvdeavavlqahqakeaa

Timeline for d2rqgb_:

• d2rqgb_ is new in SCOPe 2.04-stable
  
• d2rqgb_ appears in SCOPe 2.05
  
• d2rqgb_ appears in the current release, SCOPe 2.08