Class b: All beta proteins [48724] (176 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein) automatically mapped to Pfam PF02929 |
Protein beta-Galactosidase, domain 5 [49996] (2 species) |
Species Escherichia coli [TaxId:562] [49997] (42 PDB entries) Uniprot P00722 |
Domain d1ghoj4: 1gho J:731-1023 [24375] Other proteins in same PDB: d1ghoi1, d1ghoi2, d1ghoi3, d1ghoi5, d1ghoj1, d1ghoj2, d1ghoj3, d1ghoj5, d1ghok1, d1ghok2, d1ghok3, d1ghok5, d1ghol1, d1ghol2, d1ghol3, d1ghol5, d1ghom1, d1ghom2, d1ghom3, d1ghom5, d1ghon1, d1ghon2, d1ghon3, d1ghon5, d1ghoo1, d1ghoo2, d1ghoo3, d1ghoo5, d1ghop1, d1ghop2, d1ghop3, d1ghop5 complexed with mg complexed with mg |
PDB Entry: 1gho (more details), 2.5 Å
SCOPe Domain Sequences for d1ghoj4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ghoj4 b.30.5.1 (J:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]} paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d1ghoj4:
View in 3D Domains from same chain: (mouse over for more information) d1ghoj1, d1ghoj2, d1ghoj3, d1ghoj5 |
View in 3D Domains from other chains: (mouse over for more information) d1ghoi1, d1ghoi2, d1ghoi3, d1ghoi4, d1ghoi5, d1ghok1, d1ghok2, d1ghok3, d1ghok4, d1ghok5, d1ghol1, d1ghol2, d1ghol3, d1ghol4, d1ghol5, d1ghom1, d1ghom2, d1ghom3, d1ghom4, d1ghom5, d1ghon1, d1ghon2, d1ghon3, d1ghon4, d1ghon5, d1ghoo1, d1ghoo2, d1ghoo3, d1ghoo4, d1ghoo5, d1ghop1, d1ghop2, d1ghop3, d1ghop4, d1ghop5 |