Lineage for d2rq9a1 (2rq9 A:2-135)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2053108Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2053109Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2053110Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 protein domains)
  6. 2053401Protein automated matches [190637] (2 species)
    not a true protein
  7. 2053402Species Human (Homo sapiens) [TaxId:9606] [187699] (7 PDB entries)
  8. 2053413Domain d2rq9a1: 2rq9 A:2-135 [243747]
    Other proteins in same PDB: d2rq9a2, d2rq9a3
    automated match to d1djsb_

Details for d2rq9a1

PDB Entry: 2rq9 (more details)

PDB Description: Solution structure of human acidic fibroblast growth factor (aFGF) in the presence of a protein stabilizer NDSB-new
PDB Compounds: (A:) heparin-binding growth factor 1

SCOPe Domain Sequences for d2rq9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rq9a1 b.42.1.1 (A:2-135) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqyla
mdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthyg
qkailflplpvssd

SCOPe Domain Coordinates for d2rq9a1:

Click to download the PDB-style file with coordinates for d2rq9a1.
(The format of our PDB-style files is described here.)

Timeline for d2rq9a1: