SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2rq9a1 (2rq9 A:2-135)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2053108Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2053109Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2053110Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 protein domains)
  6. 2053401Protein automated matches [190637] (2 species)
    not a true protein
  7. 2053402Species Human (Homo sapiens) [TaxId:9606] [187699] (7 PDB entries)
  8. 2053413Domain d2rq9a1: 2rq9 A:2-135 [243747]
    Other proteins in same PDB: d2rq9a2, d2rq9a3
    automated match to d1djsb_

Details for d2rq9a1

PDB Entry: 2rq9 (more details)

PDB Description: Solution structure of human acidic fibroblast growth factor (aFGF) in the presence of a protein stabilizer NDSB-new
PDB Compounds: (A:) heparin-binding growth factor 1

SCOPe Domain Sequences for d2rq9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rq9a1 b.42.1.1 (A:2-135) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqyla
mdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthyg
qkailflplpvssd

SCOPe Domain Coordinates for d2rq9a1:

Click to download the PDB-style file with coordinates for d2rq9a1.
(The format of our PDB-style files is described here.)

Timeline for d2rq9a1: