Lineage for d2rq4a1 (2rq4 A:383-484)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2558725Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2558726Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2558762Protein CUG triplet repeat RNA-binding protein 1 [143336] (1 species)
  7. 2558763Species Human (Homo sapiens) [TaxId:9606] [143337] (2 PDB entries)
    Uniprot Q92879 383-484
  8. 2558764Domain d2rq4a1: 2rq4 A:383-484 [243745]
    Other proteins in same PDB: d2rq4a2, d2rq4a3
    automated match to d2cpza1

Details for d2rq4a1

PDB Entry: 2rq4 (more details)

PDB Description: refinement of rna binding domain 3 in cug triplet repeat rna-binding protein 1
PDB Compounds: (A:) CUG-BP- and ETR-3-like factor 1

SCOPe Domain Sequences for d2rq4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rq4a1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]}
ltqqsigaagsqkegpeganlfiyhlpqefgdqdllqmfmpfgnvvsakvfidkqtnlsk
cfgfvsydnpvsaqaaiqsmngfqigmkrlkvqlkrskndsk

SCOPe Domain Coordinates for d2rq4a1:

Click to download the PDB-style file with coordinates for d2rq4a1.
(The format of our PDB-style files is described here.)

Timeline for d2rq4a1: