Lineage for d2rq4a_ (2rq4 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908439Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1908473Protein CUG triplet repeat RNA-binding protein 1 [143336] (1 species)
  7. 1908474Species Human (Homo sapiens) [TaxId:9606] [143337] (2 PDB entries)
    Uniprot Q92879 383-484
  8. 1908475Domain d2rq4a_: 2rq4 A: [243745]
    automated match to d2cpza1

Details for d2rq4a_

PDB Entry: 2rq4 (more details)

PDB Description: refinement of rna binding domain 3 in cug triplet repeat rna-binding protein 1
PDB Compounds: (A:) CUG-BP- and ETR-3-like factor 1

SCOPe Domain Sequences for d2rq4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rq4a_ d.58.7.1 (A:) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]}
gssgssgltqqsigaagsqkegpeganlfiyhlpqefgdqdllqmfmpfgnvvsakvfid
kqtnlskcfgfvsydnpvsaqaaiqsmngfqigmkrlkvqlkrskndsksgpssg

SCOPe Domain Coordinates for d2rq4a_:

Click to download the PDB-style file with coordinates for d2rq4a_.
(The format of our PDB-style files is described here.)

Timeline for d2rq4a_: