Lineage for d2rpna1 (2rpn A:2-59)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783254Protein automated matches [190043] (8 species)
    not a true protein
  7. 2783255Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186765] (4 PDB entries)
  8. 2783261Domain d2rpna1: 2rpn A:2-59 [243742]
    Other proteins in same PDB: d2rpna2
    automated match to d1jo8a_

Details for d2rpna1

PDB Entry: 2rpn (more details)

PDB Description: a crucial role for high intrinsic specificity in the function of yeast sh3 domains
PDB Compounds: (A:) Actin-binding protein

SCOPe Domain Sequences for d2rpna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rpna1 b.34.2.1 (A:2-59) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pwataeydydaaedneltfvendkiiniefvdddwwlgelekdgskglfpsnyvslgn

SCOPe Domain Coordinates for d2rpna1:

Click to download the PDB-style file with coordinates for d2rpna1.
(The format of our PDB-style files is described here.)

Timeline for d2rpna1: