SCOPe 2.08: Domain d2rpna1: 2rpn A:2-59

Lineage for d2rpna1 (2rpn A:2-59)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein automated matches [190043] (8 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186765] (4 PDB entries)

8. Domain d2rpna1: 2rpn A:2-59 [243742]
   Other proteins in same PDB: d2rpna2
   automated match to d1jo8a_

Details for d2rpna1

PDB Entry: 2rpn

PDB Description: a crucial role for high intrinsic specificity in the function of yeast sh3 domains

PDB Compounds: (A:) Actin-binding protein

SCOPe Domain Sequences for d2rpna1:

Sequence; same for both SEQRES and ATOM records:

>d2rpna1 b.34.2.1 (A:2-59) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pwataeydydaaedneltfvendkiiniefvdddwwlgelekdgskglfpsnyvslgn

Timeline for d2rpna1:

• d2rpna1 first appeared in SCOPe 2.04, called d2rpna_
  
• d2rpna1 appears in SCOPe 2.07