![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein automated matches [190332] (5 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188825] (3 PDB entries) |
![]() | Domain d2roka1: 2rok A:430-516 [243737] Other proteins in same PDB: d2roka2, d2roka3 automated match to d1whva_ protein/RNA complex; complexed with 7mg, gdp |
PDB Entry: 2rok (more details)
SCOPe Domain Sequences for d2roka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2roka1 d.58.7.1 (A:430-516) automated matches {Mouse (Mus musculus) [TaxId: 10090]} gpdlqpkrdhvlhvtfpkewktsdlyqlfsafgniqiswiddtsafvslsqpeqvqiavn tskyaesyriqtyaeyvgkkqkgkqvk
Timeline for d2roka1: