Lineage for d2roka1 (2rok A:430-516)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952339Protein automated matches [190332] (5 species)
    not a true protein
  7. 2952433Species Mouse (Mus musculus) [TaxId:10090] [188825] (3 PDB entries)
  8. 2952437Domain d2roka1: 2rok A:430-516 [243737]
    Other proteins in same PDB: d2roka2, d2roka3
    automated match to d1whva_
    protein/RNA complex; complexed with 7mg, gdp

Details for d2roka1

PDB Entry: 2rok (more details)

PDB Description: solution structure of the cap-binding domain of parn complexed with the cap analog
PDB Compounds: (A:) Poly(A)-specific Ribonuclease

SCOPe Domain Sequences for d2roka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2roka1 d.58.7.1 (A:430-516) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gpdlqpkrdhvlhvtfpkewktsdlyqlfsafgniqiswiddtsafvslsqpeqvqiavn
tskyaesyriqtyaeyvgkkqkgkqvk

SCOPe Domain Coordinates for d2roka1:

Click to download the PDB-style file with coordinates for d2roka1.
(The format of our PDB-style files is described here.)

Timeline for d2roka1: