![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) ![]() |
![]() | Family d.58.17.0: automated matches [191590] (1 protein) not a true family |
![]() | Protein automated matches [191063] (9 species) not a true protein |
![]() | Species Thermus thermophilus [TaxId:274] [255585] (2 PDB entries) |
![]() | Domain d2roga_: 2rog A: [243736] automated match to d2xmwa_ |
PDB Entry: 2rog (more details)
SCOPe Domain Sequences for d2roga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2roga_ d.58.17.0 (A:) automated matches {Thermus thermophilus [TaxId: 274]} mlklkvegmtcnhcvmavtkalkkvpgvekvevslekgealvegtadpkalvqaveeegy kaevla
Timeline for d2roga_: