Lineage for d2roea_ (2roe A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1910055Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 1910183Family d.58.17.0: automated matches [191590] (1 protein)
    not a true family
  6. 1910184Protein automated matches [191063] (7 species)
    not a true protein
  7. 1910211Species Thermus thermophilus [TaxId:274] [255585] (2 PDB entries)
  8. 1910212Domain d2roea_: 2roe A: [243735]
    automated match to d2xmwa_

Details for d2roea_

PDB Entry: 2roe (more details)

PDB Description: solution structure of thermus thermophilus hb8 ttha1718 protein in vitro
PDB Compounds: (A:) Heavy metal binding protein

SCOPe Domain Sequences for d2roea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2roea_ d.58.17.0 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
mlklkvegmtcnhcvmavtkalkkvpgvekvevslekgealvegtadpkalvqaveeegy
kaevla

SCOPe Domain Coordinates for d2roea_:

Click to download the PDB-style file with coordinates for d2roea_.
(The format of our PDB-style files is described here.)

Timeline for d2roea_: