Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) |
Family d.58.17.0: automated matches [191590] (1 protein) not a true family |
Protein automated matches [191063] (7 species) not a true protein |
Species Thermus thermophilus [TaxId:274] [255585] (2 PDB entries) |
Domain d2roea_: 2roe A: [243735] automated match to d2xmwa_ |
PDB Entry: 2roe (more details)
SCOPe Domain Sequences for d2roea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2roea_ d.58.17.0 (A:) automated matches {Thermus thermophilus [TaxId: 274]} mlklkvegmtcnhcvmavtkalkkvpgvekvevslekgealvegtadpkalvqaveeegy kaevla
Timeline for d2roea_: