Class a: All alpha proteins [46456] (290 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
Protein automated matches [190513] (36 species) not a true protein |
Species Soybean (Glycine max) [TaxId:3847] [255586] (2 PDB entries) |
Domain d2roba_: 2rob A: [243734] automated match to d1jc2a_ complexed with ca |
PDB Entry: 2rob (more details)
SCOPe Domain Sequences for d2roba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2roba_ a.39.1.0 (A:) automated matches {Soybean (Glycine max) [TaxId: 3847]} daeeelkeafkvfdkdqngyisaselrhvminlgekltdeeveqmikeadldgdgqvnye efvkmmmtvr
Timeline for d2roba_: