| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
| Protein automated matches [190064] (21 species) not a true protein |
| Species Soybean (Glycine max) [TaxId:3847] [255584] (3 PDB entries) |
| Domain d2ro9a_: 2ro9 A: [243732] automated match to d1cmga_ complexed with ca |
PDB Entry: 2ro9 (more details)
SCOPe Domain Sequences for d2ro9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ro9a_ a.39.1.5 (A:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
dseeelkeafrvfdkdqngfisaaelrhvmtnlgekltdeevdemireadvdgdgqinye
efvkvmmak
Timeline for d2ro9a_: