SCOPe 2.08: Domain d2ro3b_: 2ro3 B:

Lineage for d2ro3b_ (2ro3 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.129: Double-split beta-barrel [89446] (2 superfamilies)
   pseudobarrel; capped on both ends by alpha-helices

4. Superfamily b.129.1: AbrB/MazE/MraZ-like [89447] (3 families)
   members of this superfamily are known or predicted to have DNA-binding function

5. Family b.129.1.3: AbrB N-terminal domain-like [54743] (3 proteins)
   dimeric fold similar to MazE; the DNA-binding site is similar to the conserved surface site of MraZ
   automatically mapped to Pfam PF04014

6. Protein Putative transition state regulator ABH [159358] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [159359] (2 PDB entries)
   Uniprot P39758 1-54

8. Domain d2ro3b_: 2ro3 B: [243730]
   automated match to d2fy9a1

Details for d2ro3b_

PDB Entry: 2ro3

PDB Description: RDC-refined Solution Structure of the N-terminal DNA Recognition Domain of the Bacillus subtilis Transition-state Regulator Abh

PDB Compounds: (B:) Putative transition state regulator abh

SCOPe Domain Sequences for d2ro3b_:

Sequence; same for both SEQRES and ATOM records:

>d2ro3b_ b.129.1.3 (B:) Putative transition state regulator ABH {Bacillus subtilis [TaxId: 1423]}
mksigvvrkvdelgrivmpielrraldiaikdsieffvdgdkiilkkykphgvc

Timeline for d2ro3b_:

• d2ro3b_ first appeared in SCOPe 2.04
  
• d2ro3b_ appears in SCOPe 2.07